PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM10G16890.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family TALE
Protein Properties Length: 545aa    MW: 57751.1 Da    PI: 6.6933
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM10G16890.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox253.1e-083063382254
                      SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      ++yps  ++  LA+++gL+ +qV +WF N R +
  OGLUM10G16890.1 306 DQYPSDVDKHILARQTGLSRSQVANWFINARVR 338
                      68*****************************88 PP

2BELL93.91.5e-30207277272
             BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                       +elq+ k kL ++leeVd+rY++y+eq++++++sFeavag  +a+ Yt+lA+++iSrhFr+L+d ++ q+
  OGLUM10G16890.1 207 AAELQRLKGKLYTMLEEVDRRYRRYCEQMRALAASFEAVAGERAAAAYTRLASRTISRHFRSLRDGVVAQL 277
                      5799****************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.0E-44140275IPR006563POX domain
PfamPF075261.3E-42146273IPR006563POX domain
SMARTSM003892.2E-4299346IPR001356Homeobox domain
SuperFamilySSF466895.43E-12305349IPR009057Homeodomain-like
PROSITE profilePS5007110.77306342IPR001356Homeobox domain
CDDcd000864.33E-9306343No hitNo description
Gene3DG3DSA:1.10.10.602.0E-16306348IPR009057Homeodomain-like
PfamPF059207.4E-12308338IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 545 aa     Download sequence    Send to blast
MAHDPSLGYA DYFAAEVDGA GATELYGLQQ HQQGVGVAEM FGVRGLMPAA HAHEQSKGVG  60
ALVVGGGGVD DGGATTLPTV HFGGLGELHH HQHRQSQAPL SLSLHRPEAA ATSLLMQQQQ  120
QHLHHQPSPP AGAASTWQLQ QGAWHLRGSR FLLPTQQLLQ EFCSLPVKST TSPSSASKAT  180
KPPQEEAAGG GGSSSWTAPT QIQSMDAAEL QRLKGKLYTM LEEVDRRYRR YCEQMRALAA  240
SFEAVAGERA AAAYTRLASR TISRHFRSLR DGVVAQLQAV RKQLGEKDTA VPGMTKGETP  300
RLRVLDQYPS DVDKHILARQ TGLSRSQVAN WFINARVRLW KPMVEEMYAE EMKDEEGSGQ  360
STQASNPQNP NPSSYTSEVR GGGGGGEDRG EQKPSRAQLL HDAGSLASVV SIGHGGAGRT  420
MVDHHHHQSL NFGMMDQLDF DAYEAAGGGQ GFGAGGGVSL TLGLQQQHAD PHDGVNVAFA  480
AAAAPPNSSG VAAEYLFMGG GGGEHQQQLP QAAQFGAVME GDAASHYRGL SATAAGFHLL  540
HDLAG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0680290.0AK068029.1 Oryza sativa Japonica Group cDNA clone:J013134A07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015614125.10.0PREDICTED: BEL1-like homeodomain protein 4
TrEMBLA0A0E0BD430.0A0A0E0BD43_9ORYZ; Uncharacterized protein
STRINGLOC_Os10g39030.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38143764
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.22e-41BEL1-like homeodomain 2